We manufacture & sell Steroid IGF LR3 rHGH Sarms.

With great quality and purity, and Guarantee Safe Delivery!!!

Home
Products
About Us
Factory Tour
Quality Control
Contact Us
Request A Quote
Home ProductsHuman Growth Peptides

CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1

Certification
Good quality Injectable Anabolic Steroids for sales
Good quality Injectable Anabolic Steroids for sales
Awesome, thanks Irina. You've actually been the fastest and most responsive so far, you're going to be getting a lottt of business from me in future.

—— Andressa Hernandez from Brazil

EllenCaisin! I test the product, it is so good! Very happy. and I gave the treats to my family, you might be the best I ever used. best service!!!

—— Gabriel Collin from Canada

Aaron Fantastic! I have received the package. Thank you very much for great packaging. If it is good quality, you must have me as a long time customer

—— Mitch Kelly from USA

Yep Koala! got package thankyou so much, Koala. I like to place another order now. how much is T3 and tren a

—— Joaquin Vega from Spain

I'm Online Chat Now

CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1

China CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 supplier
CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 supplier CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 supplier CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 supplier CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1 supplier

Large Image :  CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1

Product Details:

Place of Origin: China
Brand Name: Info@desen-nutrition.com
Certification: ISO9001,SGS,UKAS,GMP
Model Number: IGF-1 DES

Payment & Shipping Terms:

Minimum Order Quantity: Free samples Available
Price: Negotiable
Packaging Details: 10iu/vial, 10vials/kit
Delivery Time: 3-6 working days
Payment Terms: Western Union, MoneyGram, T/T,Bitcoins
Supply Ability: 10000-30000iu/month
Contact Now
Detailed Product Description
Alias: IGF-1 Long R3 Specifications: 0.1mg,1mg,1g
Synonyms: Long R3-IGF-1 Packing: Discreet Packing For Customs Pass Guaranteed
Appearance: White Lyophilized Powder CAS: 946870-92-4
High Light:

muscle building peptides

,

growth hormone peptides

IGF-I Des(1-3) Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 67 amino acids (aa 4-70) and having a molecular mass of 7368.5 Dalton.
IGF-1 Des1-3 is purified by proprietary chromatographic techniques.

 

Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1

 

Insulin-Like Growth Factor-1 DES (1-3):

 

Sequence

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK

PAKSA

Synonyms

Somatomedin C, IGF-I, IGFI, IGF1, IGF-IA, Mechano growth factor, MGF, Des(1-3), Des1-3,

Des 1-3, Des (1-3), IGF-1 (4-70).

Physical appearance Sterile Filtered White lyophilized (freeze-dried) powder
Solubility

It is recommended to reconstitute the IGF-I des(1-3) in sterile 18M-cm H2O not less than

100µg/ml, which can then be further diluted to other aqueous solutions.

Purity Greater than 97.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Usage

ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product

may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Descriptions:

 

DES IGF-1 is the shorter version of the IGF-1 chain. It is five (5) times more powerful than IGF-LR3 and ten (10) times more powerful than regular base IGF-1. The half-life for DES is about 20-30 minutes, which means this is a very delicate chain. Therefore, administration should only be done at the site where you want to see muscle growth. DES has the ability to stimulate muscle hyperplasia better than LR3. In simple terms, it's best used for site injections, rather than overall growth.

 

In addition, DES is known to bind to receptors that have been deformed by lactic acid, which is often present during workouts. This allows the DES to attach itself to a mutated receptor and signal tissue growth during training. DES can be used longer and more frequently than LR3.

 

IGF1 DES:

 

Insulin Like Growth Factor (IGF)-1 (4-70), otherwise known as IGF-1 DES, produced in E. coli, is a single, non-glycosylated, polypeptide chain containing 67 amino acids and having a molecular mass of 7,372 Da. In vitro studies demonstrate that at equal doses DES (1-3) IGF is ten times more potent than IGF-1 at stimulating hypertrophy and proliferation in cultured cells. It is likely generated through post-translational modification in the sequence of circulating mature IGF-1 via protease action.

 

IGF-1 DES is a cleaved form of IGF-1 and contains amino acids 4-70. This structure has allowed the effects of the IGF-1 protein to be amplified in the more stable form of the DES 1,3 molecule peptide protein fragment of Insulin-like growth factor 1. The IGF-1 DES, or insulin-like growth factor DES, comes from the IGF-1 family of peptides that play important roles in mammalian growth and development. IGF1 mediates many of the growth-promoting effects of growth hormone and IGF-1 DES, although shorter, pacts an equal amount of physiological altering protein physical changes. Early studies showed that growth hormone did not directly stimulate the incorporation of sulfate into cartilage, but rather acted through a serum factor, termed 'sulfation factor,' which later became known as 'somatomedin' or IGF-1 and more recently through truncation, DES IGF-1.

 

CAS 946870-92-4 Human Growth Peptides IGF-1 DES 1mg Insulin-Like Growth Factor LONG IGF-1

 

Dosage:

 

DES IGF-1 can be dosed at 50-150mcg multiple times a day (prior to training) into specific target areas. since DES has such a short half life (20-30 minutes), desensitization was not noticed at all . Injection sites should be localized; preferably, at the muscle group you want to grow. In simple terms, if you want to grow your biceps, inject IGF-1 DES right into your bicep.

 

IGF-1 vs. HGH:

 

Why IGF-1 and not GH? Growth hormone actually is a precursor to IGF-1. Growth hormone does not directly cause muscle growth, but indirectly causes muscle growth by signaling the release of IGF-1. Human Growth Hormone (HGH) can be very expensive, and to see muscle growth it needs to be paired with insulin or other anabolic steroids. This makes IGF-1 variants like LR3 and DES, which can be used as a standalone drug, a much more viable option for bodybuilder looking to see solid recovery of damaged tissue and muscle growth.

 

Receptor Grade vs Media Grade IGF-1 LR3:


Genuine Receptor Grade LR3 IGF-I is a high quality research reagent for use in studies on cell growth, IGF receptors and IGF binding proteins and is more potent than rH IGF-1 and Media Grade IGF-1 LR3 both in vivo and in vitro due to the drastic increase in biological activity (stronger affinity for binding with the IGF receptor) and high-level purity. This combination of increased biological activity and purity is what sets Receptor Grade IGF-1 LR3 apart from standard IGF-1. Media grade LR3 IGF-I is more commonly used in commercial cell culture vs mammalian. It can also be used as a research reagent at an economical cost to enable studies where biological potency is of less value and higher quantities are required. To maximize results in an animal-based cell study or production Receptor Grade IGF-1 Long R3 should be used exclusively.

 

Do you have any reshipment policy?

 

We have good after-sale service and re-shipment policy if the parcel lose.
Our long association with our clients has brought great benefits.
We always take the upmost care in the packaging of our products .
Our clients will confirm this as even they struggle to find them without help at times.
But in spite of our best efforts it is still possible will seize a small number of packages.
In this circumstance we promise reship free to establish long term relationship.

 

Shipping:

 

1. Preferentially DHL or HKEMS for quantity less than 50KG;
2. Sea shipping for quantity over 60KG. 100% safe!
3. Send from our agent in Netherlands, Singapore, Laos, USA

 

Any Inquiry Or Suggestion Is Highly Appreciated!

Contact Details
Hengyang Desen Biotechnology Co., Ltd.

Contact Person: Irina

Tel: +8618908446935

Send your inquiry directly to us (0 / 3000)