Home ProductsHuman Growth Peptides

Sermorelin GHRH (1-29) 86168-78-7 Human Growth Peptides , growth peptides bodybuilding

Certification
China Hengyang Desen Biotechnology Co., Ltd. certification
China Hengyang Desen Biotechnology Co., Ltd. certification
Customer Reviews
Awesome, thanks Irina. You've actually been the fastest and most responsive so far, you're going to be getting a lottt of business from me in future.

—— Andressa Hernandez from Brazil

EllenCaisin! I test the product, it is so good! Very happy. and I gave the treats to my family, you might be the best I ever used. best service!!!

—— Gabriel Collin from Canada

Aaron Fantastic! I have received the package. Thank you very much for great packaging. If it is good quality, you must have me as a long time customer

—— Mitch Kelly from USA

Yep Koala! got package thankyou so much, Koala. I like to place another order now. how much is T3 and tren a

—— Joaquin Vega from Spain

I'm Online Chat Now

Sermorelin GHRH (1-29) 86168-78-7 Human Growth Peptides , growth peptides bodybuilding

large.img.alt
small.img.alt small.img.alt small.img.alt small.img.alt small.img.alt

Large Image :  Sermorelin GHRH (1-29) 86168-78-7 Human Growth Peptides , growth peptides bodybuilding

Product Details:
Place of Origin: China
Brand Name: ChineseHormone
Certification: ISO9001,SGS,UKAS
Model Number: CAS:86168-78-7
Payment & Shipping Terms:
Minimum Order Quantity: Free samples Available
Price: Negotiable
Packaging Details: Discreet package or as required
Delivery Time: 3-6 working days
Payment Terms: T/T, Western Union, MoneyGram,BItcoins
Supply Ability: 500 kg / month
Detailed Product Description
Assay: 99% Character: White Powder
Grade: Pharmaceutical Grade Packing: Discreet Ways Of Packing For Customs Pass Guaranteed
High Light:

peptides for muscle growth

,

muscle building peptides

 Sermorelin GHRH (1-29) 86168-78-7 Polypeptide diagnostic agent doping agent

 

Product Name:Sermorelin (2mg/vial)
Synonyms:Sermorelina;Sermoreline;Sermorelinum;Geref;GHRH(1-29)
CAS:86168-78-7
MF:C149H246N44O42S
MW:3357.88
Appearance:white powder

 

Description:


Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues. It stimulates the pituitary gland to naturally produce increased amounts of human growth hormone.

 

Sermorelin,also known as GHRH (1-29), is a growth hormone-releasing hormone (GHRH) analogue used as a diagnostic agent. It is a 29-amino acid polypeptide representing the 1-29 fragment from endogenous human GHRH, and is thought to be the shortest fully functional fragment of GHRH.
It is used as a diagnostic agent to assess growth hormone (GH) secretion.
It is also used as doping agent in sports due to its correlation with increased growth of muscular and skeletal tissue.


Sermorelin use is also hypothesized to improve deep rapid eye movement sleep.

 

Product Name: Sermorelin
Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357.88
Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Mol File: 86168-78-7.mol
Sermorelin Structure

 

 Specifications:

 

Product name
Sermorelin

Appearance

White Powder

Assay

98%

Molecular formula
C149H246N44O42S

Molecular weight
3357.88

Package

2mg/vial or as your request

Shipping

Fast and secure shipping by DHL,EMS,UPS,TNT, FedEx..

Shipping leading time

Within 12 hours after receiving the payment

Payment Terms

Western Union, Money Gram , T/T, PayPal

Price

Negotiable

 

Dosage and Usage:

 

Sermorelin, along with the other peptides you will use, comes as a delicate lyophilized powder that should be kept out of the light and in a cool dry place. Reconstitution is done with bacteriostatic water (BC water) or sodium chloride meant for injection.

 

Injections can be administered one hour before workout at a dose of 200mcg-300mcg. Normally, Sermorelin injections are taken before bed at around 300mcgs. Of course, as with any GHRH, you will want to use this peptide alongside a GHRP like GHRP-2 or Ipamorelin for maximum release of growth hormone stores. Ideally, though user could still benefit from using a GHRH like CJC 1295 with DAC and a GHRP like Ipamorelin throughout the day and then utilize Sermorelin as a pre-bed timed dose. Do not discount Sermorelin as simply an anti-aging peptide. It can still help promote the growth of lean body mass and increase the availability of IGF-1 in the blood stream.

 

Side Effects:

 

Sermorelin is pretty mild in terms of side effects, but, like most peptides, it has the ability to bring on head rush, flush feeling, some swelling at injection site, dizziness, and nausea. I could not find any cases where prolactin or cortisol levels were elevated by the use of Sermorelin. As always, listen to your body and follow a dosing protocol that is in tune with you goals.

 

Function:

Increases the development of lean body mass through the development of new muscle cells.
Reduces body fat through lipolysis.
Increases energy and vitality.
Increases strength.
Increases endurance.
Accelerates healing from wounds or surgery.
Strengthens the heart.
Enhances the immune system.

Improves sleep quality.
Increases calcium retention, and strengthens and increases the mineralization of bone or bone density.
Increases protein synthesis and stimulates the growth of all internal organs except the brain.

 

Application:

Sermorelin works by promoting the secretion of Human Hormone from the pituitary gland. It stimulates the pituitary gland to naturally produce increased amounts of human hormone. The increased volume of human hormone produced by the pituitary gland causes an increase in the production of Insulin-Like Factor-1 by the liver and results in the benefits of treatment provided to the adult patient.

Contact Details
Hengyang Desen Biotechnology Co., Ltd.

Contact Person: Sales Manager

Send your inquiry directly to us (0 / 3000)