Sermorelin GHRH (1-29) 86168-78-7 Human Growth Peptides , growth peptides bodybuilding

 Sermorelin GHRH (1-29) 86168-78-7 Polypeptide diagnostic agent doping agent

Product Name:Sermorelin (2mg/vial)
Synonyms:Sermorelina;Sermoreline;Sermorelinum;Geref;GHRH(1-29)
CAS:86168-78-7
MF:C149H246N44O42S
MW:3357.88
Appearance:white powder

Description:

Sermorelin acetate is the acetate salt of an amidated synthetic 29-amino acid peptide (GRF 1-29 NH 2 ) that corresponds to the amino-terminal segment of the naturally occurring human growth hormone-releasing hormone (GHRH or GRF) consisting of 44 amino acid residues. It stimulates the pituitary gland to naturally produce increased amounts of human growth hormone.

Sermorelin,also known as GHRH (1-29), is a growth hormone-releasing hormone (GHRH) analogue used as a diagnostic agent. It is a 29-amino acid polypeptide representing the 1-29 fragment from endogenous human GHRH, and is thought to be the shortest fully functional fragment of GHRH.
It is used as a diagnostic agent to assess growth hormone (GH) secretion.
It is also used as doping agent in sports due to its correlation with increased growth of muscular and skeletal tissue.

Sermorelin use is also hypothesized to improve deep rapid eye movement sleep.

Product Name:	Sermorelin
Synonyms:	SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2 HUMAN;H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2;GROWTH HORMONE RELEASING FACTOR (1-29), AMIDE, HUMAN;GRF (1-29) AMIDE (HUMAN)
CAS:	86168-78-7
MF:	C149H246N44O42S
MW:	3357.88
Product Categories:	Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-RHPeptides for Cell Biology;Growth Hormone Releasing Factors;Neuropeptides;Neurotransmission (Obesity);Releasing Factors
Mol File:	86168-78-7.mol

 Specifications:

Dosage and Usage:

Sermorelin, along with the other peptides you will use, comes as a delicate lyophilized powder that should be kept out of the light and in a cool dry place. Reconstitution is done with bacteriostatic water (BC water) or sodium chloride meant for injection.

Injections can be administered one hour before workout at a dose of 200mcg-300mcg. Normally, Sermorelin injections are taken before bed at around 300mcgs. Of course, as with any GHRH, you will want to use this peptide alongside a GHRP like GHRP-2 or Ipamorelin for maximum release of growth hormone stores. Ideally, though user could still benefit from using a GHRH like CJC 1295 with DAC and a GHRP like Ipamorelin throughout the day and then utilize Sermorelin as a pre-bed timed dose. Do not discount Sermorelin as simply an anti-aging peptide. It can still help promote the growth of lean body mass and increase the availability of IGF-1 in the blood stream.

Side Effects:

Sermorelin is pretty mild in terms of side effects, but, like most peptides, it has the ability to bring on head rush, flush feeling, some swelling at injection site, dizziness, and nausea. I could not find any cases where prolactin or cortisol levels were elevated by the use of Sermorelin. As always, listen to your body and follow a dosing protocol that is in tune with you goals.

Function:

Increases the development of lean body mass through the development of new muscle cells.
Reduces body fat through lipolysis.
Increases energy and vitality.
Increases strength.
Increases endurance.
Accelerates healing from wounds or surgery.
Strengthens the heart.
Enhances the immune system.

Improves sleep quality.
Increases calcium retention, and strengthens and increases the mineralization of bone or bone density.
Increases protein synthesis and stimulates the growth of all internal organs except the brain.
 

Application:

Sermorelin works by promoting the secretion of Human Hormone from the pituitary gland. It stimulates the pituitary gland to naturally produce increased amounts of human hormone. The increased volume of human hormone produced by the pituitary gland causes an increase in the production of Insulin-Like Factor-1 by the liver and results in the benefits of treatment provided to the adult patient.

Any needs, please contact me

Email: tonyraws810@gmail.com

Whatsapp: 86-15871352379

Wickr: tonyraws